GPD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119453
Artikelname: GPD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119453
Hersteller Artikelnummer: orb2119453
Alternativnummer: BYT-ORB2119453-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human GPD2
Konjugation: Biotin
Alternative Synonym: GDH2, GPDM, mGDH, mGPDH
GPD2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 000399
UniProt: P43304
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNHVVDISESGLITI