ALDH3A2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119468
Artikelname: ALDH3A2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119468
Hersteller Artikelnummer: orb2119468
Alternativnummer: BYT-ORB2119468-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALDH3A2
Konjugation: Biotin
Alternative Synonym: SLS, FALDH, ALDH10
ALDH3A2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 001026976
UniProt: P51648
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR