OCA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119495
Artikelname: OCA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119495
Hersteller Artikelnummer: orb2119495
Alternativnummer: BYT-ORB2119495-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OCA2
Konjugation: Biotin
Alternative Synonym: P, BEY, PED, BEY1, BEY2, BOCA, EYCL, HCL3, EYCL2, EYCL3, SHEP1, D15S12
OCA2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 000266
UniProt: Q04671
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGG