SGCB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119513
Artikelname: SGCB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119513
Hersteller Artikelnummer: orb2119513
Alternativnummer: BYT-ORB2119513-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SGCB
Konjugation: Biotin
Alternative Synonym: A3b, SGC, LGMD2E, LGMDR4
SGCB Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 000223
UniProt: Q16585
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RIGPNGCDSMELHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN