GHR Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2119530
Artikelname: GHR Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2119530
Hersteller Artikelnummer: orb2119530
Alternativnummer: BYT-ORB2119530-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GHR
Konjugation: FITC
Alternative Synonym: GHBP, GHIP
GHR Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 000154
UniProt: P10912
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF