GAA Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2119536
| Artikelname: |
GAA Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2119536 |
| Hersteller Artikelnummer: |
orb2119536 |
| Alternativnummer: |
BYT-ORB2119536-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the following sequence APTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRST |
| Konjugation: |
FITC |
| Alternative Synonym: |
LYAG |
| GAA Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
105 kDa |
| NCBI: |
000143 |
| UniProt: |
P10253 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: APTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRST |
