G6PC Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2119542
Artikelname: G6PC Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2119542
Hersteller Artikelnummer: orb2119542
Alternativnummer: BYT-ORB2119542-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human G6PC
Konjugation: FITC
Alternative Synonym: G6PC, G6PT, GSD1, GSD1a, G6Pase
G6PC Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 000142
UniProt: P35575
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM