EPOR Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2119554
| Artikelname: |
EPOR Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2119554 |
| Hersteller Artikelnummer: |
orb2119554 |
| Alternativnummer: |
BYT-ORB2119554-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human EPOR |
| Konjugation: |
FITC |
| Alternative Synonym: |
EPO-R |
| EPOR Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
53kDa |
| NCBI: |
000112 |
| UniProt: |
P19235 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL |
