ATP7A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2119568
Artikelname: ATP7A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2119568
Hersteller Artikelnummer: orb2119568
Alternativnummer: BYT-ORB2119568-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATP7A
Konjugation: HRP
Alternative Synonym: MK, MNK, DSMAX, SMAX3
ATP7A Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
UniProt: Q04656
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: MGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQKSPSEISVH