ATP7A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119570
Artikelname: ATP7A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119570
Hersteller Artikelnummer: orb2119570
Alternativnummer: BYT-ORB2119570-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATP7A
Konjugation: Biotin
Alternative Synonym: MK, MNK, DSMAX, SMAX3
ATP7A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
UniProt: Q04656
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQKSPSEISVH