PSEN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2119571
Artikelname: PSEN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2119571
Hersteller Artikelnummer: orb2119571
Alternativnummer: BYT-ORB2119571-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSEN1
Konjugation: HRP
Alternative Synonym: AD3, FAD, PS1, PS-1, S182, ACNINV3
PSEN1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 000012
UniProt: P49768
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY