SLC46A3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119627
Artikelname: SLC46A3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119627
Hersteller Artikelnummer: orb2119627
Alternativnummer: BYT-ORB2119627-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC46A3
Konjugation: Biotin
Alternative Synonym: FKSG16
SLC46A3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 861450
UniProt: Q7Z3Q1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC