SLCO6A1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2119661
Artikelname: SLCO6A1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2119661
Hersteller Artikelnummer: orb2119661
Alternativnummer: BYT-ORB2119661-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLCO6A1
Konjugation: HRP
Alternative Synonym: GST, CT48, OATPY, OATP-I, OATP6A1
SLCO6A1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 775759
UniProt: Q86UG4
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK