SLC24A4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2119670
Artikelname: SLC24A4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2119670
Hersteller Artikelnummer: orb2119670
Alternativnummer: BYT-ORB2119670-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC24A4
Konjugation: HRP
Alternative Synonym: AI2A5, NCKX4, SHEP6, SLC24A2
SLC24A4 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 705932
UniProt: Q8NFF2
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI