SLC24A4 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2119671
Artikelname: SLC24A4 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2119671
Hersteller Artikelnummer: orb2119671
Alternativnummer: BYT-ORB2119671-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC24A4
Konjugation: FITC
Alternative Synonym: AI2A5, NCKX4, SHEP6, SLC24A2
SLC24A4 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 705932
UniProt: Q8NFF2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI