SLC5A8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119702
Artikelname: SLC5A8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119702
Hersteller Artikelnummer: orb2119702
Alternativnummer: BYT-ORB2119702-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC5A8
Konjugation: Biotin
Alternative Synonym: AIT, SMCT, SMCT1
SLC5A8 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 666018
UniProt: Q8N695
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC