SLC22A16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2119765
| Artikelname: |
SLC22A16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2119765 |
| Hersteller Artikelnummer: |
orb2119765 |
| Alternativnummer: |
BYT-ORB2119765-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A16 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
CT2, OAT6, OCT6, OKB1, FLIPT2, HEL-S-18, dJ261K5.1 |
| SLC22A16 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
63kDa |
| NCBI: |
149116 |
| UniProt: |
Q96RU0 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR |
