Abcf1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2120425
Artikelname: Abcf1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2120425
Hersteller Artikelnummer: orb2120425
Alternativnummer: BYT-ORB2120425-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Konjugation: Biotin
Alternative Synonym: Abc50
Abcf1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 95kDa
NCBI: 001103353
UniProt: Q6MG08
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQDPPELLKRPREYTVRFT