MARCH11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2120608
Artikelname: MARCH11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2120608
Hersteller Artikelnummer: orb2120608
Alternativnummer: BYT-ORB2120608-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MARHB
Konjugation: Biotin
Alternative Synonym: RNF226, MARCH11, MARCH-XI
MARCH11 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 001096032
UniProt: A6NNE9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLTALRNRNL