LONRF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2120623
Artikelname: LONRF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2120623
Hersteller Artikelnummer: orb2120623
Alternativnummer: BYT-ORB2120623-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LONRF2
Konjugation: Biotin
Alternative Synonym: RNF192
LONRF2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 84kDa
NCBI: 940863
UniProt: Q1L5Z9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSV