RNF149 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2120687
Artikelname: RNF149 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2120687
Hersteller Artikelnummer: orb2120687
Alternativnummer: BYT-ORB2120687-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF149
Konjugation: HRP
Alternative Synonym: DNAPTP2
RNF149 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 775918
UniProt: Q8NC42
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWL