UBR3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2120700
Artikelname: UBR3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2120700
Hersteller Artikelnummer: orb2120700
Alternativnummer: BYT-ORB2120700-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence HSQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGK
Konjugation: FITC
Alternative Synonym: ZNF650
UBR3 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 212 kDa
NCBI: 742067
UniProt: Q6ZT12
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HSQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGK