RNF217 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2120732
Artikelname: RNF217 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2120732
Hersteller Artikelnummer: orb2120732
Alternativnummer: BYT-ORB2120732-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF217
Konjugation: HRP
Alternative Synonym: OSTL, IBRDC1, C6orf172, dJ84N20.1
RNF217 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 689766
UniProt: Q8TC41
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: GLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQV