WDSUB1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2120739
Artikelname: WDSUB1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2120739
Hersteller Artikelnummer: orb2120739
Alternativnummer: BYT-ORB2120739-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDSUB1
Konjugation: FITC
Alternative Synonym: UBOX6, WDSAM1
WDSUB1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 689741
UniProt: Q8N9V3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS