FBXO24 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2120803
Artikelname: FBXO24 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2120803
Hersteller Artikelnummer: orb2120803
Alternativnummer: BYT-ORB2120803-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXO24
Konjugation: Biotin
Alternative Synonym: FBX24
FBXO24 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 277041
UniProt: O75426
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LCATRECLYILSSHDIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMA