TRIM51 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2120814
Artikelname: TRIM51 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2120814
Hersteller Artikelnummer: orb2120814
Alternativnummer: BYT-ORB2120814-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TRIM51
Konjugation: FITC
Alternative Synonym: SPRYD5, TRIM51A
TRIM51 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
UniProt: Q9BSJ1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PVNPELSAGPITGLLDSLSGFRVDFTLQPERANSHIFLCGDLRSMNVGCD