TRIM63 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2120825
Artikelname: TRIM63 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2120825
Hersteller Artikelnummer: orb2120825
Alternativnummer: BYT-ORB2120825-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRIM63
Konjugation: HRP
Alternative Synonym: IRF, SMRZ, MURF1, MURF2, RNF28
TRIM63 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 115977
UniProt: Q969Q1
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: TIITQLEDSRRVTKENSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQ