Unkl Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2120908
Artikelname: Unkl Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2120908
Hersteller Artikelnummer: orb2120908
Alternativnummer: BYT-ORB2120908-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Unkl
Konjugation: Biotin
Alternative Synonym: 1300004G08Rik
Unkl Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 083065
UniProt: B9EKD9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IASLDKDLEEQDLGLTGLNGVPGSIWDFVSGSFSPSPSPILNSGPSASSS