MARCH7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2120914
Artikelname: MARCH7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2120914
Hersteller Artikelnummer: orb2120914
Alternativnummer: BYT-ORB2120914-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human MARCH7
Konjugation: Biotin
Alternative Synonym: AXO, AXOT, MARCH7, RNF177, MARCH-VII
MARCH7 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 001269735
UniProt: F5H6W4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LSARMMSGSRGSSLNDTYHSRDSSFRLDSEYQSTSASASASPFQSAWYSE