RNF25 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2120920
Artikelname: RNF25 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2120920
Hersteller Artikelnummer: orb2120920
Alternativnummer: BYT-ORB2120920-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF25
Konjugation: Biotin
Alternative Synonym: AO7
RNF25 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 071898
UniProt: Q96BH1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG