RNF150 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2120941
Artikelname: RNF150 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2120941
Hersteller Artikelnummer: orb2120941
Alternativnummer: BYT-ORB2120941-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF150
Konjugation: Biotin
RNF150 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 32kDa
UniProt: Q9ULK6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ALGIPPNADCMDDLPTDFEGSLGGPPTNQITGASDTTVNESSVTLDPAVR