Bfar Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2121022
| Artikelname: |
Bfar Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2121022 |
| Hersteller Artikelnummer: |
orb2121022 |
| Alternativnummer: |
BYT-ORB2121022-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Bar, RNF, Rnf47, AI666707, AW107665, 3110001I22, 3010001A07Rik, 3110001I22Rik |
| Bfar Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
53kDa |
| NCBI: |
080252 |
| UniProt: |
Q8R079 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: NDVVQSLAAFQKYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVIL |
