UBE2J1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2121043
| Artikelname: |
UBE2J1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2121043 |
| Hersteller Artikelnummer: |
orb2121043 |
| Alternativnummer: |
BYT-ORB2121043-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2J1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
UBC6, UBC6E, Ubc6p, CGI-76, NCUBE1, HSPC153, HSPC205, NCUBE-1, HSU93243 |
| UBE2J1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
35kDa |
| NCBI: |
057105 |
| UniProt: |
Q9Y385 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD |
