UBE2T Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2121127
Artikelname: UBE2T Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2121127
Hersteller Artikelnummer: orb2121127
Alternativnummer: BYT-ORB2121127-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2T
Konjugation: Biotin
Alternative Synonym: FANCT, PIG50, HSPC150
UBE2T Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 054895
UniProt: Q9NPD8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGV