MKRN2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2121133
Artikelname: MKRN2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2121133
Hersteller Artikelnummer: orb2121133
Alternativnummer: BYT-ORB2121133-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MKRN2
Konjugation: Biotin
Alternative Synonym: RNF62, HSPC070
MKRN2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 054879
UniProt: Q9H000
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: STKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRC