FBXL5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2121199
Artikelname: FBXL5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2121199
Hersteller Artikelnummer: orb2121199
Alternativnummer: BYT-ORB2121199-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXL5
Konjugation: Biotin
Alternative Synonym: FBL4, FBL5, FLR1
FBXL5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 76kDa
NCBI: 036293
UniProt: Q9UKA1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES