BRAP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2121238
Artikelname: BRAP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2121238
Hersteller Artikelnummer: orb2121238
Alternativnummer: BYT-ORB2121238-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BRAP
Konjugation: Biotin
Alternative Synonym: IMP, BRAP2, RNF52
BRAP Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 006759
UniProt: Q7Z569
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS