C20orf18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2121250
Artikelname: C20orf18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2121250
Hersteller Artikelnummer: orb2121250
Alternativnummer: BYT-ORB2121250-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C20orf18
Konjugation: Biotin
Alternative Synonym: XAP3, XAP4, HOIL1, PBMEI, PGBM1, RBCK2, RNF54, HOIL-1, ZRANB4, C20orf18, UBCE7IP3
C20orf18 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 006453
UniProt: Q86SL2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRS