Mkrn3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2121277
Artikelname: Mkrn3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2121277
Hersteller Artikelnummer: orb2121277
Alternativnummer: BYT-ORB2121277-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Mkrn3
Konjugation: Biotin
Mkrn3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 001057262
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPTASSSSLPLIGSAAE