PEX10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2121361
Artikelname: PEX10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2121361
Hersteller Artikelnummer: orb2121361
Alternativnummer: BYT-ORB2121361-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PEX10
Konjugation: Biotin
Alternative Synonym: NALD, PBD6A, PBD6B, RNF69
PEX10 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 002608
UniProt: O60683
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR