TBXA2R Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2121388
Artikelname: TBXA2R Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2121388
Hersteller Artikelnummer: orb2121388
Alternativnummer: BYT-ORB2121388-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TBXA2R
Konjugation: Biotin
Alternative Synonym: TXA2-R, BDPLT13
TBXA2R Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 001051
UniProt: P21731
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EYSGAISAHCNLRLPGSSDSSASACQVAGTTGTRPSWMQPPCLPSRWWAS