RADIL Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2121480
Artikelname: RADIL Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2121480
Hersteller Artikelnummer: orb2121480
Alternativnummer: BYT-ORB2121480-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RADIL
Konjugation: FITC
Alternative Synonym: RASIP2
RADIL Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 63kDa
UniProt: Q96JH8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETA