GTPBP10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2121484
Artikelname: GTPBP10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2121484
Hersteller Artikelnummer: orb2121484
Alternativnummer: BYT-ORB2121484-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GTPBP10
Konjugation: Biotin
Alternative Synonym: ObgH2, UG0751c10
GTPBP10 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 149098
UniProt: A4D1E9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFL