Rgs10 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2121576
Artikelname: Rgs10 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2121576
Hersteller Artikelnummer: orb2121576
Alternativnummer: BYT-ORB2121576-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FACS, WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: FITC
Alternative Synonym: 2310010N19Rik
Rgs10 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 080694
UniProt: Q9CQE5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE