Anxa6 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2121594
Artikelname: Anxa6 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2121594
Hersteller Artikelnummer: orb2121594
Alternativnummer: BYT-ORB2121594-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse Anxa6
Konjugation: FITC
Alternative Synonym: A, An, Cab, Cam, Anx6, Cabm, Camb, AnxVI, AW107198
Anxa6 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 74kDa
NCBI: 038500
UniProt: P14824
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LISLATGNREEGGENRDQAQEDAQVAAEILEIADTPSGDKTSLETRFMTV