CYP1A1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2123829
| Artikelname: |
CYP1A1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2123829 |
| Hersteller Artikelnummer: |
orb2123829 |
| Alternativnummer: |
BYT-ORB2123829-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1 |
| Konjugation: |
FITC |
| Alternative Synonym: |
AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX |
| CYP1A1 Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
58kDa |
| NCBI: |
000490 |
| UniProt: |
P04798 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |
