WNT2B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2124091
| Artikelname: |
WNT2B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2124091 |
| Hersteller Artikelnummer: |
orb2124091 |
| Alternativnummer: |
BYT-ORB2124091-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human WNT2B |
| Konjugation: |
Biotin |
| Alternative Synonym: |
WNT13 |
| WNT2B Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
41kDa |
| NCBI: |
004176 |
| UniProt: |
Q93097 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
