CARF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2124751
Artikelname: CARF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2124751
Hersteller Artikelnummer: orb2124751
Alternativnummer: BYT-ORB2124751-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CARF
Konjugation: Biotin
Alternative Synonym: CARF
CARF Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 060102
UniProt: Q9NXV6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS