Rrp7a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2124838
Artikelname: Rrp7a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2124838
Hersteller Artikelnummer: orb2124838
Alternativnummer: BYT-ORB2124838-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rrp7a
Konjugation: Biotin
Alternative Synonym: Cgi-96, RGD1311547
Rrp7a Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 001124040
UniProt: D4AE65
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KERRKRARKELLSFYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKF