RBM9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2124922
| Artikelname: |
RBM9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2124922 |
| Hersteller Artikelnummer: |
orb2124922 |
| Alternativnummer: |
BYT-ORB2124922-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human RBM9 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
RTA, fxh, FOX2, RBM9, Fox-2, HNRBP2, HRNBP2, dJ106I20.3 |
| RBM9 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
39kDa |
| NCBI: |
055124 |
| UniProt: |
O43251 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT |
